STIMATE Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-TMEM110 Antibody: synthetic peptide directed towards the N terminal of human TMEM110. Synthetic peptide located within the following region: MQGPAGNASRGLPGGPPSTVASGAGRCESGALMHSFGIFLQGLLGVVAFS |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 33 kDa |
| Gene Name | transmembrane protein 110 |
| Database Link | |
| Background | The function of this protein remains unknown. |
| Synonyms | DKFZp667E1121; DKFZp779M0254; FLJ37613; FLJ42395; MGC52022 |
| Note | Immunogen sequence homology: Human: 100%; Rabbit: 100%; Rat: 86% |
| Reference Data | |
| Protein Categories | Intracellular Proteins, Membrane Proteins |
| Protein Families | Transmembrane |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
STIMATE-Mustn1 Fusion Protein Prevents Ca2+ Overload in Cells That Present Increased SOCE
Berna-Erro, Camello, Granados et al
FASEB J (2026) 40 (4), e71507 DOI: 10.1096/fj.202501504R
Berna-Erro, Camello, Granados et al
FASEB J (2026) 40 (4), e71507 DOI: 10.1096/fj.202501504R
AI Summary: OriGene’s anti-STIMATE antibody (catalog #TA333351) was used in this study to detect and analyze STIMATE protein expression, contributing to the investigation of how STIMATE and its fusion with mustn1 affect calcium entry and cell function in platelets and cell lines.
Snippet: following, they were exposed to the specific primary antibodies, such as the anti-STIMATE antibody (1:1000 for 2 h;Origene #TA333351), anti-mustn1 antibody (1:500 for 2 h;Sigma-Aldrich #ABD115), anti-STIM1 antibody (1:1000 for 2 h;BD Bioscience #610954 clone 44/GOK), and anti-Orai1 antibody (1:250 overnight at
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
