OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BLCAP (NM_006698) Human Mass Spec Standard

Be the first to review this product
SKU
PH308259
BLCAP MS Standard C13 and N15-labeled recombinant protein (NP_006689)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA315122 Rabbit polyclonal anti-BLCAP antibody
100 ul
$380.00
LY416478 Transient overexpression lysate of bladder cancer associated protein (BLCAP), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "BLCAP or NM_006698"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208259
Predicted MW 9.7 kDa
Protein Sequence
Protein Sequence
>RC208259 representing NM_006698
Red=Cloning site Green=Tags(s)

MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCWGNCFLYHC
SDSPLPESAHDPGVVGT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006689
RefSeq Size 2057
RefSeq ORF 261
Synonyms BC10
Locus ID 10904
UniProt ID P62952
Cytogenetics 20q11.23
Summary This gene encodes a protein that reduces cell growth by stimulating apoptosis. Alternative splicing and the use of alternative promoters result in multiple transcript variants encoding the same protein. This gene is imprinted in brain where different transcript variants are expressed from each parental allele. Transcript variants initiating from the upstream promoter are expressed preferentially from the maternal allele, while transcript variants initiating downstream of the interspersed NNAT gene (GeneID:4826) are expressed from the paternal allele. Transcripts at this locus may also undergo A to I editing, resulting in amino acid changes at three positions in the N-terminus of the protein. provided by RefSeq, Nov 2015
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "BLCAP" proteins (3)
SKU Description Size Price
LC416478 Lyophilized BLCAP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416478 Transient overexpression lysate of bladder cancer associated protein (BLCAP), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP308259 Recombinant protein of human bladder cancer associated protein (BLCAP), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products