BLCAP (NM_006698) Human Tagged ORF Clone

SKU
RC208259
BLCAP (Myc-DDK-tagged)-Human bladder cancer associated protein (BLCAP), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol BLCAP
Synonyms BC10
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC208259 representing NM_006698
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTATTGCCTCCAGTGGCTGCTGCCCGTCCTCCTCATCCCCAAGCCCCTCAACCCCGCCCTGTGGTTCA
GCCACTCCATGTTCATGGGCTTCTACCTGCTCAGCTTCCTCCTGGAACGGAAGCCTTGCACAATTTGTGC
CTTGGTTTTCCTGGCAGCCCTGTTCCTTATCTGCTATAGCTGCTGGGGAAACTGTTTCCTGTACCACTGC
TCCGATTCCCCGCTTCCAGAATCGGCGCATGATCCCGGCGTTGTGGGCACC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208259 representing NM_006698
Red=Cloning site Green=Tags(s)

MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCWGNCFLYHC
SDSPLPESAHDPGVVGT

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006698
ORF Size 261 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006698.4
RefSeq Size 2057 bp
RefSeq ORF 264 bp
Locus ID 10904
UniProt ID P62952
Cytogenetics 20q11.23
Protein Families Transmembrane
MW 9.7 kDa
Summary This gene encodes a protein that reduces cell growth by stimulating apoptosis. Alternative splicing and the use of alternative promoters result in multiple transcript variants encoding the same protein. This gene is imprinted in brain where different transcript variants are expressed from each parental allele. Transcript variants initiating from the upstream promoter are expressed preferentially from the maternal allele, while transcript variants initiating downstream of the interspersed NNAT gene (GeneID:4826) are expressed from the paternal allele. Transcripts at this locus may also undergo A to I editing, resulting in amino acid changes at three positions in the N-terminus of the protein. [provided by RefSeq, Nov 2015]
Write Your Own Review
You're reviewing:BLCAP (NM_006698) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC208259L3 Lenti ORF clone of Human bladder cancer associated protein (BLCAP), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC208259L4 Lenti ORF clone of Human bladder cancer associated protein (BLCAP), transcript variant 1, mGFP tagged 10 ug
$450.00
RG208259 BLCAP (tGFP-tagged) - Human bladder cancer associated protein (BLCAP), transcript variant 1 10 ug
$489.00
SC115959 BLCAP (untagged)-Human bladder cancer associated protein (BLCAP), transcript variant 1 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.