OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DNAAF11 (NM_012472) Human Mass Spec Standard

Be the first to review this product
SKU
PH308256
LRRC6 MS Standard C13 and N15-labeled recombinant protein (NP_036604)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA806109 LRRC6 mouse monoclonal antibody, clone OTI7E9 (formerly 7E9) 100 ul
$447.00
LY415734 Transient overexpression lysate of leucine rich repeat containing 6 (LRRC6) (as WB positive control) 100 ug
$436.00

Other products for "DNAAF11 or NM_012472"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208256
Predicted MW 54.3 kDa
Protein Sequence
Protein Sequence
>RC208256 protein sequence
Red=Cloning site Green=Tags(s)

MGWITEDLIRRNAEHNDCVIFSLEELSLHQQEIERLEHIDKWCRDLKILYLQNNLIGKIENVSKLKKLEY
LNLALNNIEKIENLEGCEELAKLDLTVNFIGELSSIKNLQHNIHLKELFLMGNPCASFDHYREFVVATLP
QLKWLDGKEIEPSERIKALQDYSVIEPQIREQEKDHCLKRAKLKEEAQRKHQEEDKNEDKRSNAGFDGRW
YTDINATLSSLESKDHLQAPDTEEHNTKKLDNSEDDLEFWNKPCLFTPESRLETLRHMEKQRKKQEKLSE
KKKKVKPPRTLITEDGKALNVNEPKIDFSLKDNEKQIILDLAVYRYMDTSLIDVDVQPTYVRVMIKGKPF
QLVLPAEVKPDSSSAKRSQTTGHLVICMPKVGEVITGGQRAFKSMKTTSDRSREQTNTRSKHMEKLEVDP
SKHSFPDVTNIVQEKKHTPRRRPEPKIIPSEEDPTFEDNPEVPPLI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036604
RefSeq Size 1888
RefSeq ORF 1398
Synonyms CILD19; LRRC6; LRTP; tilB; TSLRP
Locus ID 23639
UniProt ID Q86X45
Cytogenetics 8q24.22
Summary The protein encoded by this gene contains several leucine-rich repeat domains and appears to be involved in the motility of cilia. Defects in this gene are a cause of primary ciliary dyskinesia-19 (CILD19). Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 4, 11 and 22. provided by RefSeq, Apr 2016
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DNAAF11" proteins (4)
SKU Description Size Price
LC415734 Lyophilized LRRC6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415734 Transient overexpression lysate of leucine rich repeat containing 6 (LRRC6) (as WB positive control) 100 ug
$436.00
TP308256 Recombinant protein of human leucine rich repeat containing 6 (LRRC6), 20 µg 20 ug
$737.00
TP710153 Recombinant protein of human leucine rich repeat containing 6 (LRRC6), full length, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$540.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products