OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

KCNIP1 (NM_014592) Human Mass Spec Standard

Be the first to review this product
SKU
PH308255
KCNIP1 MS Standard C13 and N15-labeled recombinant protein (NP_055407)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA368603 KCNIP1 rabbit polyclonal antibody
100 ul
$310.00
LY415191 Transient overexpression lysate of Kv channel interacting protein 1 (KCNIP1), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "KCNIP1 or NM_014592"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208255
Predicted MW 25.2 kDa
Protein Sequence
Protein Sequence
>RC208255 protein sequence
Red=Cloning site Green=Tags(s)

MGAVMGTFSSLQTKQRRPSKDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLYRGFKNECPSGVVN
EDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDG
YINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQ
LFQNVM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055407
RefSeq Size 2028
RefSeq ORF 648
Synonyms KCHIP1; VABP
Locus ID 30820
UniProt ID Q9NZI2
Cytogenetics 5q35.1
Summary This gene encodes a member of the family of cytosolic voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the neuronal calcium sensor (NCS) family of the calcium binding EF-hand proteins. They associate with Kv4 alpha subunits to form native Kv4 channel complexes. The encoded protein may regulate rapidly inactivating (A-type) currents, and hence neuronal membrane excitability, in response to changes in the concentration of intracellular calcium. Alternative splicing results in multiple transcript variants encoding different isoforms. provided by RefSeq, May 2013
Protein Families Druggable Genome, Ion Channels: Other
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "KCNIP1" proteins (3)
SKU Description Size Price
LC415191 Lyophilized KCNIP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415191 Transient overexpression lysate of Kv channel interacting protein 1 (KCNIP1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP308255 Recombinant protein of human Kv channel interacting protein 1 (KCNIP1), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products