OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

OLIG2 (NM_005806) Human Mass Spec Standard

Be the first to review this product
SKU
PH308209
OLIG2 MS Standard C13 and N15-labeled recombinant protein (NP_005797)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA349037 Rabbit Polyclonal Anti-OLIG2 Antibody
100 ug
$640.00
LY417055 Transient overexpression lysate of oligodendrocyte lineage transcription factor 2 (OLIG2) (as WB positive control) 100 ug
$436.00

Other products for "OLIG2 or NM_005806"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208209
Predicted MW 32.4 kDa
Protein Sequence
Protein Sequence
>Peptide sequence encoded by RC208209
Blue=ORF Red=Cloning site Green=Tag(s)

MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDK
LGGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKRMHDLNIAMDGLREVMPYA
HGPSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGHHAGFHPSACGGLAHSAPLPAATAHPAA
AAHAAHHPAVHHPILPPAAAAAAAAAAAAAVSSASLPGSGLPSVGSIRPPHGLLKSPSAAAAAPLGGGG
GGSGASGGFQHWGGMPCPCSMCQVPPPHHHVSAMGAGSLPRLTSDAK
myc-FLAG tag

Recombinant protein using RC208209 also available, TP308209
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005797
RefSeq Size 2505
RefSeq ORF 969
Synonyms BHLHB1; bHLHe19; OLIGO2; PRKCBP2; RACK17
Locus ID 10215
UniProt ID Q13516
Cytogenetics 21q22.11
Summary This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "OLIG2" proteins (4)
SKU Description Size Price
LC417055 Lyophilized OLIG2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417055 Transient overexpression lysate of oligodendrocyte lineage transcription factor 2 (OLIG2) (as WB positive control) 100 ug
$436.00
TP308209 Recombinant protein of human oligodendrocyte lineage transcription factor 2 (OLIG2), 20 µg 20 ug
$867.00
TP762359 Purified recombinant protein of Human oligodendrocyte lineage transcription factor 2 (OLIG2), Met1-Arg120, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$260.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products