OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DCUN1D3 (NM_173475) Human Mass Spec Standard

Be the first to review this product
SKU
PH308082
DCUN1D3 MS Standard C13 and N15-labeled recombinant protein (NP_775746)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA337791 Rabbit Polyclonal Anti-DCUN1D3 Antibody
100 ul
$585.00
LY406608 Transient overexpression lysate of DCN1, defective in cullin neddylation 1, domain containing 3 (S. cerevisiae) (DCUN1D3) (as WB positive control) 100 ug
$436.00

Other products for "DCUN1D3 or NM_173475"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208082
Predicted MW 34.3 kDa
Protein Sequence
Protein Sequence
>RC208082 protein sequence
Red=Cloning site Green=Tags(s)

MGQCVTKCKNPSSTLGSKNGDREPSNKSHSRRGAGHREEQVPPCGKPGGDILVNGTKKAEAATEACQLPT
SSGDAGRESKSNAEESSLQRLEELFRRYKDEREDAILEEGMERFCNDLCVDPTEFRVLLLAWKFQAATMC
KFTRKEFFDGCKAISADSIDGICARFPSLLTEAKQEDKFKDLYRFTFQFGLDSEEGQRSLHREIAIALWK
LVFTQNNPPVLDQWLNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLSNYSEDEAWPSLFDTFVEWEMER
RKREGEGRGALSSGPEGLCPEEQT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_775746
RefSeq Size 2886
RefSeq ORF 912
Synonyms 44M2.4; SCCRO3
Locus ID 123879
UniProt ID Q8IWE4
Cytogenetics 16p12.3
Summary Antagonizes DCUN1D1-mediated CUL1 neddylation by sequestering CUL1 at the cell membrane (PubMed:25349211). When overexpressed in transformed cells, may promote mesenchymal to epithelial-like changes and inhibit colony formation in soft agar (PubMed:25349211).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DCUN1D3" proteins (3)
SKU Description Size Price
LC406608 Lyophilized DCUN1D3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406608 Transient overexpression lysate of DCN1, defective in cullin neddylation 1, domain containing 3 (S. cerevisiae) (DCUN1D3) (as WB positive control) 100 ug
$436.00
TP308082 Recombinant protein of human DCN1, defective in cullin neddylation 1, domain containing 3 (S. cerevisiae) (DCUN1D3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products