DCUN1D3 (NM_173475) Human Recombinant Protein

SKU
TP308082
Recombinant protein of human DCN1, defective in cullin neddylation 1, domain containing 3 (S. cerevisiae) (DCUN1D3), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208082 protein sequence
Red=Cloning site Green=Tags(s)

MGQCVTKCKNPSSTLGSKNGDREPSNKSHSRRGAGHREEQVPPCGKPGGDILVNGTKKAEAATEACQLPT
SSGDAGRESKSNAEESSLQRLEELFRRYKDEREDAILEEGMERFCNDLCVDPTEFRVLLLAWKFQAATMC
KFTRKEFFDGCKAISADSIDGICARFPSLLTEAKQEDKFKDLYRFTFQFGLDSEEGQRSLHREIAIALWK
LVFTQNNPPVLDQWLNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLSNYSEDEAWPSLFDTFVEWEMER
RKREGEGRGALSSGPEGLCPEEQT

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 34.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_775746
Locus ID 123879
UniProt ID Q8IWE4
Cytogenetics 16p12.3
RefSeq Size 2886
RefSeq ORF 912
Synonyms 44M2.4; SCCRO3
Summary Antagonizes DCUN1D1-mediated CUL1 neddylation by sequestering CUL1 at the cell membrane (PubMed:25349211). When overexpressed in transformed cells, may promote mesenchymal to epithelial-like changes and inhibit colony formation in soft agar (PubMed:25349211).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:DCUN1D3 (NM_173475) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH308082 DCUN1D3 MS Standard C13 and N15-labeled recombinant protein (NP_775746) 10 ug
$3,255.00
LC406608 DCUN1D3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406608 Transient overexpression lysate of DCN1, defective in cullin neddylation 1, domain containing 3 (S. cerevisiae) (DCUN1D3) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.