DCUN1D3 (NM_173475) Human Mass Spec Standard

SKU
PH308082
DCUN1D3 MS Standard C13 and N15-labeled recombinant protein (NP_775746)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208082]
Predicted MW 34.3 kDa
Protein Sequence
Protein Sequence
>RC208082 protein sequence
Red=Cloning site Green=Tags(s)

MGQCVTKCKNPSSTLGSKNGDREPSNKSHSRRGAGHREEQVPPCGKPGGDILVNGTKKAEAATEACQLPT
SSGDAGRESKSNAEESSLQRLEELFRRYKDEREDAILEEGMERFCNDLCVDPTEFRVLLLAWKFQAATMC
KFTRKEFFDGCKAISADSIDGICARFPSLLTEAKQEDKFKDLYRFTFQFGLDSEEGQRSLHREIAIALWK
LVFTQNNPPVLDQWLNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLSNYSEDEAWPSLFDTFVEWEMER
RKREGEGRGALSSGPEGLCPEEQT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_775746
RefSeq Size 2886
RefSeq ORF 912
Synonyms 44M2.4; SCCRO3
Locus ID 123879
UniProt ID Q8IWE4
Cytogenetics 16p12.3
Summary Antagonizes DCUN1D1-mediated CUL1 neddylation by sequestering CUL1 at the cell membrane (PubMed:25349211). When overexpressed in transformed cells, may promote mesenchymal to epithelial-like changes and inhibit colony formation in soft agar (PubMed:25349211).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:DCUN1D3 (NM_173475) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC406608 DCUN1D3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406608 Transient overexpression lysate of DCN1, defective in cullin neddylation 1, domain containing 3 (S. cerevisiae) (DCUN1D3) 100 ug
$436.00
TP308082 Recombinant protein of human DCN1, defective in cullin neddylation 1, domain containing 3 (S. cerevisiae) (DCUN1D3), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.