OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HSPC111 (NOP16) (NM_016391) Human Mass Spec Standard

Be the first to review this product
SKU
PH308009
NOP16 MS Standard C13 and N15-labeled recombinant protein (NP_057475)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA345030 Rabbit Polyclonal Anti-HSPC111 Antibody - middle region
100 ul
$585.00
LY413994 Transient overexpression lysate of NOP16 nucleolar protein homolog (yeast) (NOP16) (as WB positive control) 100 ug
$436.00

Other products for "HSPC111 or NM_016391"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208009
Predicted MW 21.2 kDa
Protein Sequence
Protein Sequence
>RC208009 protein sequence
Red=Cloning site Green=Tags(s)

MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVPLRK
RKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNY
YQDTPKQIRSKINVYKRFYPAEWQDFLDSLQKRKMEVE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057475
RefSeq Size 1071
RefSeq ORF 534
Synonyms HSPC111; HSPC185
Locus ID 51491
UniProt ID Q9Y3C1
Cytogenetics 5q35.2
Summary This gene encodes a protein that is localized to the nucleolus. Expression of this gene is induced by estrogens and Myc protein and is a marker of poor patient survival in breast cancer. Alternative splicing results in multiple transcript variants. provided by RefSeq, Dec 2015
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HSPC111" proteins (3)
SKU Description Size Price
LC413994 Lyophilized NOP16 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413994 Transient overexpression lysate of NOP16 nucleolar protein homolog (yeast) (NOP16) (as WB positive control) 100 ug
$436.00
TP308009 Recombinant protein of human NOP16 nucleolar protein homolog (yeast) (NOP16), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products