HSPC111 (NOP16) (NM_016391) Human Recombinant Protein

SKU TP308009

Recombinant protein of human NOP16 nucleolar protein homolog (yeast) (NOP16), 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208009 protein sequence; Red=Cloning site Green=Tags(s); ; MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVPLRK; RKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNY; YQDTPKQIRSKINVYKRFYPAEWQDFLDSLQKRKMEVE; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 21 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_057475
• Locus ID: 51491
• UniProt ID: Q9Y3C1
• Cytogenetics: 5q35.2
• RefSeq Size: 1071
• RefSeq ORF: 534
• Synonyms: HSPC111; HSPC185
• Summary: This gene encodes a protein that is localized to the nucleolus. Expression of this gene is induced by estrogens and Myc protein and is a marker of poor patient survival in breast cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]
• Protein Families: Druggable Genome