OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

COMMD7 (NM_053041) Human Mass Spec Standard

Be the first to review this product
SKU
PH307984
COMMD7 MS Standard C13 and N15-labeled recombinant protein (NP_444269)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA326676 Rabbit Polyclonal COMMD7 Antibody
100 ug
$640.00
LY409337 Transient overexpression lysate of COMM domain containing 7 (COMMD7), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "COMMD7 or NM_053041"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207984
Predicted MW 22.6 kDa
Protein Sequence
Protein Sequence
>RC207984 protein sequence
Red=Cloning site Green=Tags(s)

MGRLHCTEDPVPEAVGGDMQQLNQLGAQQFSALTEVLFHFLTEQKEVERFLAQLSEFATTNQISLGSLRS
IVKSLLLVPNGALKKSLTAKQVQADFITLGLSEEKATYFSEKWKQNTPTLARWAIGQTLMINQLIDMEWK
FGVTSGSSELEKVGSIFLQLKLVVKKGNQTKNVYIELTLPQFYSFLHEMERVRTSMECFC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_444269
RefSeq Size 1928
RefSeq ORF 600
Synonyms C20orf92; dJ1085F17.3
Locus ID 149951
UniProt ID Q86VX2
Cytogenetics 20q11.21
Summary May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes (PubMed:21778237). Associates with the NF-kappa-B complex and suppresses its transcriptional activity (PubMed:15799966).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "COMMD7" proteins (5)
SKU Description Size Price
LC409337 Lyophilized COMMD7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420436 Lyophilized COMMD7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409337 Transient overexpression lysate of COMM domain containing 7 (COMMD7), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY420436 Transient overexpression lysate of COMM domain containing 7 (COMMD7), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP307984 Recombinant protein of human COMM domain containing 7 (COMMD7), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products