COMMD7 (NM_053041) Human Recombinant Protein

SKU
TP307984
Recombinant protein of human COMM domain containing 7 (COMMD7), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC207984 protein sequence
Red=Cloning site Green=Tags(s)

MGRLHCTEDPVPEAVGGDMQQLNQLGAQQFSALTEVLFHFLTEQKEVERFLAQLSEFATTNQISLGSLRS
IVKSLLLVPNGALKKSLTAKQVQADFITLGLSEEKATYFSEKWKQNTPTLARWAIGQTLMINQLIDMEWK
FGVTSGSSELEKVGSIFLQLKLVVKKGNQTKNVYIELTLPQFYSFLHEMERVRTSMECFC

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 22.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_444269
Locus ID 149951
UniProt ID Q86VX2
Cytogenetics 20q11.21
RefSeq Size 1928
RefSeq ORF 600
Synonyms C20orf92; dJ1085F17.3
Summary May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes (PubMed:21778237). Associates with the NF-kappa-B complex and suppresses its transcriptional activity (PubMed:15799966).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:COMMD7 (NM_053041) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH307984 COMMD7 MS Standard C13 and N15-labeled recombinant protein (NP_444269) 10 ug
$3,255.00
LC409337 COMMD7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420436 COMMD7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409337 Transient overexpression lysate of COMM domain containing 7 (COMMD7), transcript variant 1 100 ug
$436.00
LY420436 Transient overexpression lysate of COMM domain containing 7 (COMMD7), transcript variant 2 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.