OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MSANTD4 (NM_032424) Human Mass Spec Standard

Be the first to review this product
SKU
PH307940
KIAA1826 MS Standard C13 and N15-labeled recombinant protein (NP_115800)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA337390 Rabbit Polyclonal Anti-MSANTD4 Antibody
100 ul
$585.00
LY410120 Transient overexpression lysate of KIAA1826 (KIAA1826) (as WB positive control) 100 ug
$436.00

Other products for "MSANTD4 or NM_032424"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207940
Predicted MW 41.1 kDa
Protein Sequence
Protein Sequence
>RC207940 protein sequence
Red=Cloning site Green=Tags(s)

MKQLKRKRKSNFSVQETQTLLKEITKRKEVIFSKQLNTTINVMKRMAWEEIAQCVNAVGEGEQRTGTEVK
RRYLDWRALMKRKRMKANIKLVGSGFPLPSSDLDDSLTEEIDEKIGFRNDANFDWQNVADFRDAGGSLTE
VKVEEEERDPQSPEFEIEEEEEMLSSVIPDSRRENELPDFPHIDEFFTLNSTPSRSAYDEPHLLVNIEKQ
KLELEKRRLDIEAERLQVEKERLQIEKERLRHLDMEHERLQLEKERLQIEREKLRLQIVNSEKPSLENEL
GQGEKSMLQPQDIETEKLKLERERLQLEKDRLQFLKFESEKLQIEKERLQVEKDRLRIQKEGHLQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115800
RefSeq Size 4095
RefSeq ORF 1035
Synonyms KIAA1826
Locus ID 84437
UniProt ID Q8NCY6
Cytogenetics 11q22.3
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MSANTD4" proteins (4)
SKU Description Size Price
LC410120 Lyophilized MSANTD4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410120 Transient overexpression lysate of KIAA1826 (KIAA1826) (as WB positive control) 100 ug
$436.00
TP307940 Recombinant protein of human KIAA1826 (KIAA1826), 20 µg 20 ug
$737.00
TP761512 Purified recombinant protein of Human KIAA1826 (KIAA1826), full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products