MSANTD4 (NM_032424) Human Recombinant Protein

SKU
TP307940
Recombinant protein of human KIAA1826 (KIAA1826), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC207940 protein sequence
Red=Cloning site Green=Tags(s)

MKQLKRKRKSNFSVQETQTLLKEITKRKEVIFSKQLNTTINVMKRMAWEEIAQCVNAVGEGEQRTGTEVK
RRYLDWRALMKRKRMKANIKLVGSGFPLPSSDLDDSLTEEIDEKIGFRNDANFDWQNVADFRDAGGSLTE
VKVEEEERDPQSPEFEIEEEEEMLSSVIPDSRRENELPDFPHIDEFFTLNSTPSRSAYDEPHLLVNIEKQ
KLELEKRRLDIEAERLQVEKERLQIEKERLRHLDMEHERLQLEKERLQIEREKLRLQIVNSEKPSLENEL
GQGEKSMLQPQDIETEKLKLERERLQLEKDRLQFLKFESEKLQIEKERLQVEKDRLRIQKEGHLQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 41 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_115800
Locus ID 84437
UniProt ID Q8NCY6
Cytogenetics 11q22.3
RefSeq Size 4095
RefSeq ORF 1035
Synonyms KIAA1826
Write Your Own Review
You're reviewing:MSANTD4 (NM_032424) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH307940 KIAA1826 MS Standard C13 and N15-labeled recombinant protein (NP_115800) 10 ug
$3,255.00
LC410120 MSANTD4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410120 Transient overexpression lysate of KIAA1826 (KIAA1826) 100 ug
$436.00
TP761512 Purified recombinant protein of Human KIAA1826 (KIAA1826), full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.