OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

beta 2 Microglobulin (B2M) (NM_004048) Human Mass Spec Standard

Be the first to review this product
SKU
PH307587
B2M MS Standard C13 and N15-labeled recombinant protein (NP_004039)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA802776JM B2M mouse monoclonal antibody,clone 1A9, Magnetic Beads 1 ml
$798.00
LY401311 Transient overexpression lysate of beta-2-microglobulin (B2M) (as WB positive control) 100 ug
$436.00

Other products for "beta 2 Microglobulin or NM_004048"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207587
Predicted MW 13.71 kDa
Protein Sequence
Protein Sequence
>RC207587 representing NM_004048
Red=Cloning site Green=Tags(s)

MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVE
HSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004039
RefSeq Size 987
RefSeq ORF 357
Synonyms IMD43
Locus ID 567
UniProt ID P61769
Cytogenetics 15q21.1
Summary This gene encodes a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells. The protein has a predominantly beta-pleated sheet structure that can form amyloid fibrils in some pathological conditions. The encoded antimicrobial protein displays antibacterial activity in amniotic fluid. A mutation in this gene has been shown to result in hypercatabolic hypoproteinemia.provided by RefSeq, Aug 2014
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Antigen processing and presentation
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "beta 2 Microglobulin" proteins (6)
SKU Description Size Price
LC401311 Lyophilized B2M HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401311 Transient overexpression lysate of beta-2-microglobulin (B2M) (as WB positive control) 100 ug
$436.00
TP307587 Recombinant protein of human beta-2-microglobulin (B2M), 20 µg 20 ug
$737.00
TP710178 Recombinant protein of human beta-2-microglobulin (B2M), residues 21-119aa, secretory expressed with GP67 signal peptide, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$540.00
TP720425 Recombinant protein of human beta-2-microglobulin (B2M) 10 ug
$275.00
TP750209 Purified recombinant protein of human beta-2-microglobulin(B2M), Ile21-Met119, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$240.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products