OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GNMT (NM_018960) Human Mass Spec Standard

Be the first to review this product
SKU
PH307497
GNMT MS Standard C13 and N15-labeled recombinant protein (NP_061833)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA501276 Anti-GNMT mouse monoclonal antibody, clone OTI8A3 (formerly 8A3) 100 ul
$447.00
LY412848 Transient overexpression lysate of glycine N-methyltransferase (GNMT) (as WB positive control) 100 ug
$436.00

Other products for "GNMT or NM_018960"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207497
Predicted MW 32.7 kDa
Protein Sequence
Protein Sequence
>RC207497 protein sequence
Red=Cloning site Green=Tags(s)

MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGV
DSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLG
NSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVL
IVNNKAHMVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQ
TYIPCYFIHVLKRTD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_061833
RefSeq Size 1091
RefSeq ORF 885
Synonyms HEL-S-182mP
Locus ID 27232
UniProt ID Q14749
Cytogenetics 6p21.1
Summary The protein encoded by this gene is an enzyme that catalyzes the conversion of S-adenosyl-L-methionine (along with glycine) to S-adenosyl-L-homocysteine and sarcosine. This protein is found in the cytoplasm and acts as a homotetramer. Defects in this gene are a cause of GNMT deficiency (hypermethioninemia). Alternative splicing results in multiple transcript variants. Naturally occurring readthrough transcription occurs between the upstream CNPY3 (canopy FGF signaling regulator 3) gene and this gene and is represented with GeneID:107080644. provided by RefSeq, Jan 2016
Protein Families Druggable Genome
Protein Pathways Glycine, serine and threonine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GNMT" proteins (4)
SKU Description Size Price
LC412848 Lyophilized GNMT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412848 Transient overexpression lysate of glycine N-methyltransferase (GNMT) (as WB positive control) 100 ug
$436.00
TP307497 Recombinant protein of human glycine N-methyltransferase (GNMT), 20 µg 20 ug
$867.00
TP720534 Recombinant protein of human glycine N-methyltransferase (GNMT) 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products