OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DEXI (NM_014015) Human Mass Spec Standard

Be the first to review this product
SKU
PH307463
DEXI MS Standard C13 and N15-labeled recombinant protein (NP_054734)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA375426 DEXI Rabbit polyclonal Antibody
100 ul
$410.00
LY415520 Transient overexpression lysate of Dexi homolog (mouse) (DEXI) (as WB positive control) 100 ug
$436.00

Other products for "DEXI or NM_014015"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207463
Predicted MW 10.4 kDa
Protein Sequence
Protein Sequence
>RC207463 protein sequence
Red=Cloning site Green=Tags(s)

MLGARVAAHLDALGPLVPYVPPPLLPSMFYVGLFFVNVLILYYAFLMEYIVLNVGLVFLPEDMDQALVDL
GVLSDPGSGLYDADSELDVFDAYLE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_054734
RefSeq Size 1580
RefSeq ORF 285
Synonyms MYLE
Locus ID 28955
UniProt ID O95424
Cytogenetics 16p13.13
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DEXI" proteins (3)
SKU Description Size Price
LC415520 Lyophilized DEXI HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415520 Transient overexpression lysate of Dexi homolog (mouse) (DEXI) (as WB positive control) 100 ug
$436.00
TP307463 Recombinant protein of human dexamethasone-induced transcript (DEXI), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products