OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CRY2 (NM_021117) Human Mass Spec Standard

Be the first to review this product
SKU
PH307337
CRY2 MS Standard C13 and N15-labeled recombinant protein (NP_066940)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA502905 CRY2 mouse monoclonal antibody, clone OTI1H5 (formerly 1H5) 100 ul
$447.00
LY412078 Transient overexpression lysate of cryptochrome 2 (photolyase-like) (CRY2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "CRY2 or NM_021117"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207337
Predicted MW 66.9 kDa
Protein Sequence
Protein Sequence
>RC207337 protein sequence
Red=Cloning site Green=Tags(s)

MAATVATAAAVAPAPAPGTDSASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINR
WRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAG
VEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDETYG
VPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLS
CRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWA
EGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLS
CSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKAFPSRYIYEPWNAPESIQKAAKCIIGVDYPRPIV
NHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSHPVAEPSSSQAGSMSSAGPRPLPSGPASPK
RKLEAAEEPPGEELSKRARVAELPTPELPSKDA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_066940
RefSeq Size 4204
RefSeq ORF 1779
Synonyms HCRY2; PHLL2
Locus ID 1408
UniProt ID Q49AN0
Cytogenetics 11p11.2
Summary This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. This gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Two transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Feb 2014
Protein Families Druggable Genome
Protein Pathways Circadian rhythm - mammal
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CRY2" proteins (5)
SKU Description Size Price
LC412078 Lyophilized CRY2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432326 Lyophilized CRY2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412078 Transient overexpression lysate of cryptochrome 2 (photolyase-like) (CRY2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY432326 Transient overexpression lysate of cryptochrome 2 (photolyase-like) (CRY2), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP307337 Recombinant protein of human cryptochrome 2 (photolyase-like) (CRY2), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products