OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FHIT (NM_002012) Human Mass Spec Standard

Be the first to review this product
SKU
PH307120
FHIT MS Standard C13 and N15-labeled recombinant protein (NP_002003)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA811440 FHIT mouse monoclonal antibody,clone OTI1D7 100 ul
$447.00
LY419588 Transient overexpression lysate of fragile histidine triad gene (FHIT), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "FHIT or NM_002012"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207120
Predicted MW 16.9 kDa
Protein Sequence
Protein Sequence
>RC207120 protein sequence
Red=Cloning site Green=Tags(s)

MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVE
KHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAA
ALRVYFQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002003
RefSeq Size 1103
RefSeq ORF 441
Synonyms AP3Aase; FRA3B
Locus ID 2272
UniProt ID P49789
Cytogenetics 3p14.2
Summary The protein encoded by this gene is a P1-P3-bis(5'-adenosyl) triphosphate hydrolase involved in purine metabolism. This gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. The encoded protein is also a tumor suppressor, as loss of its activity results in replication stress and DNA damage. provided by RefSeq, Aug 2017
Protein Pathways Non-small cell lung cancer, Purine metabolism, Small cell lung cancer
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FHIT" proteins (6)
SKU Description Size Price
LC419588 Lyophilized FHIT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431768 Lyophilized FHIT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419588 Transient overexpression lysate of fragile histidine triad gene (FHIT), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY431768 Transient overexpression lysate of fragile histidine triad gene (FHIT), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP307120 Recombinant protein of human fragile histidine triad gene (FHIT), 20 µg 20 ug
$867.00
TP328740 Recombinant protein of human fragile histidine triad gene (FHIT), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products