OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FHIT (NM_001166243) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP328740
Recombinant protein of human fragile histidine triad gene (FHIT), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA811440 FHIT mouse monoclonal antibody,clone OTI1D7 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "FHIT or NM_001166243"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC228740 protein sequence
Red=Cloning site Green=Tags(s)

MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVE
KHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAA
ALRVYFQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 16.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001159715
Locus ID 2272
UniProt ID P49789
Cytogenetics 3p14.2
RefSeq Size 1122
RefSeq ORF 441
Synonyms AP3Aase; FRA3B
Summary The protein encoded by this gene is a P1-P3-bis(5'-adenosyl) triphosphate hydrolase involved in purine metabolism. This gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. The encoded protein is also a tumor suppressor, as loss of its activity results in replication stress and DNA damage. provided by RefSeq, Aug 2017
Protein Categories Cancer: Lung, Intracellular Proteins
Protein Pathways Non-small cell lung cancer, Purine metabolism, Small cell lung cancer
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FHIT" proteins (6)
SKU Description Size Price
PH307120 FHIT MS Standard C13 and N15-labeled recombinant protein (NP_002003) 10 ug
$3,360.00
LC419588 Lyophilized FHIT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431768 Lyophilized FHIT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419588 Transient overexpression lysate of fragile histidine triad gene (FHIT), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY431768 Transient overexpression lysate of fragile histidine triad gene (FHIT), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP307120 Recombinant protein of human fragile histidine triad gene (FHIT), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products