OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CA5B (NM_007220) Human Mass Spec Standard

Be the first to review this product
SKU
PH307002
CA5B MS Standard C13 and N15-labeled recombinant protein (NP_009151)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA374174 CA5B Rabbit polyclonal Antibody
100 ul
$410.00
LY416110 Transient overexpression lysate of carbonic anhydrase VB, mitochondrial (CA5B), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$436.00

Other products for "CA5B or NM_007220"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207002
Predicted MW 36.43 kDa
Protein Sequence
Protein Sequence
>RC207002 representing NM_007220
Red=Cloning site Green=Tags(s)

MVVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIR
WRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWG
SEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALV
EFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDN
FRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_009151
RefSeq Size 6032
RefSeq ORF 951
Synonyms CA-VB; CAVB
Locus ID 11238
UniProt ID Q9Y2D0
Cytogenetics Xp22.2
Summary Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. This gene encodes carbonic anhydrase 5B. CA5B, and the related CA5A gene, has its expression localized in the mitochondria though CA5B has a wider tissue distribution than CA5A, which is restricted to the liver, kidneys, and skeletal muscle. A carbonic anhydrase pseudogene (CA5BP1) is adjacent to the CA5B gene and these two loci produce CA5BP1-CA5B readthrough transcripts. provided by RefSeq, Jan 2019
Protein Families Druggable Genome
Protein Pathways Nitrogen metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CA5B" proteins (4)
SKU Description Size Price
LC416110 Lyophilized CA5B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416110 Transient overexpression lysate of carbonic anhydrase VB, mitochondrial (CA5B), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$436.00
TP307002 Recombinant protein of human carbonic anhydrase VB, mitochondrial (CA5B), nuclear gene encoding mitochondrial protein, 20 µg 20 ug
$867.00
TP720091 Recombinant protein of human carbonic anhydrase VB, mitochondrial (CA5B), nuclear gene encoding mitochondrial protein 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products