CA5B (NM_007220) Human Recombinant Protein

SKU
TP307002
Recombinant protein of human carbonic anhydrase VB, mitochondrial (CA5B), nuclear gene encoding mitochondrial protein, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC207002 representing NM_007220
Red=Cloning site Green=Tags(s)

MVVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIR
WRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWG
SEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALV
EFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDN
FRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 32.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_009151
Locus ID 11238
UniProt ID Q9Y2D0
Cytogenetics Xp22.2
RefSeq Size 6032
RefSeq ORF 951
Synonyms CA-VB; CAVB
Summary Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. This gene encodes carbonic anhydrase 5B. CA5B, and the related CA5A gene, has its expression localized in the mitochondria though CA5B has a wider tissue distribution than CA5A, which is restricted to the liver, kidneys, and skeletal muscle. A carbonic anhydrase pseudogene (CA5BP1) is adjacent to the CA5B gene and these two loci produce CA5BP1-CA5B readthrough transcripts. [provided by RefSeq, Jan 2019]
Protein Families Druggable Genome
Protein Pathways Nitrogen metabolism
Write Your Own Review
You're reviewing:CA5B (NM_007220) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH307002 CA5B MS Standard C13 and N15-labeled recombinant protein (NP_009151) 10 ug
$3,255.00
LC416110 CA5B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416110 Transient overexpression lysate of carbonic anhydrase VB, mitochondrial (CA5B), nuclear gene encoding mitochondrial protein 100 ug
$436.00
TP720091 Recombinant protein of human carbonic anhydrase VB, mitochondrial (CA5B), nuclear gene encoding mitochondrial protein 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.