OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD244 (NM_016382) Human Mass Spec Standard

Be the first to review this product
SKU
PH306988
CD244 MS Standard C13 and N15-labeled recombinant protein (NP_057466)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA812270 CD244 mouse monoclonal antibody,clone OTI1B12 100 ul
$447.00
LY413990 Transient overexpression lysate of CD244 molecule, natural killer cell receptor 2B4 (CD244), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "CD244 or NM_016382"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206988
Predicted MW 41.1 kDa
Protein Sequence
Protein Sequence
>RC206988 protein sequence
Red=Cloning site Green=Tags(s)

MLGQVVTLILLLLLKVYQGKGCQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWE
NGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFDKVEKPRLQGQGKI
LDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLT
QDCQNAHQEFRFWPFLVIIVILSALFLGTLACFCVWRRKRKEKQSETSPKEFLTIYEDVKDLKTRRNHEQ
EQTFPGGGSTIYSMIQSQSSAPTSQEPAYTLYSLIQPSRKSGSRKRNHSPSFNSTIYEVIGKSQPKAQNP
ARLSRKELENFDVYS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057466
RefSeq Size 2528
RefSeq ORF 1095
Synonyms 2B4; NAIL; NKR2B4; Nmrk; SLAMF4
Locus ID 51744
UniProt ID Q9BZW8
Cytogenetics 1q23.3
Summary This gene encodes a cell surface receptor expressed on natural killer (NK) cells (and some T cells) that mediate non-major histocompatibility complex (MHC) restricted killing. The interaction between NK-cell and target cells via this receptor is thought to modulate NK-cell cytolytic activity. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.provided by RefSeq, Oct 2009
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Natural killer cell mediated cytotoxicity
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CD244" proteins (8)
SKU Description Size Price
LC413990 Lyophilized CD244 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432954 Lyophilized CD244 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413990 Transient overexpression lysate of CD244 molecule, natural killer cell receptor 2B4 (CD244), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY432954 Transient overexpression lysate of CD244 molecule, natural killer cell receptor 2B4 (CD244), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP306988 Recombinant protein of human CD244 molecule, natural killer cell receptor 2B4 (CD244), 20 µg 20 ug
$867.00
TP329806 Purified recombinant protein of Homo sapiens CD244 molecule, natural killer cell receptor 2B4 (CD244), transcript variant 3, 20 µg 20 ug
$867.00
TP723933 Recombinant human 2B4 protein with C-terminal mouse Fc and 6×His tag 100 ug
$770.00
TP724012 Recombinant human 2B4 protein with C-terminal human Fc tag 100 ug
$825.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products