CD244 (NM_016382) Human Recombinant Protein

SKU
TP306988
Recombinant protein of human CD244 molecule, natural killer cell receptor 2B4 (CD244), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206988 protein sequence
Red=Cloning site Green=Tags(s)

MLGQVVTLILLLLLKVYQGKGCQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWE
NGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFDKVEKPRLQGQGKI
LDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLT
QDCQNAHQEFRFWPFLVIIVILSALFLGTLACFCVWRRKRKEKQSETSPKEFLTIYEDVKDLKTRRNHEQ
EQTFPGGGSTIYSMIQSQSSAPTSQEPAYTLYSLIQPSRKSGSRKRNHSPSFNSTIYEVIGKSQPKAQNP
ARLSRKELENFDVYS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 39 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_057466
Locus ID 51744
UniProt ID Q9BZW8
Cytogenetics 1q23.3
RefSeq Size 2528
RefSeq ORF 1095
Synonyms 2B4; NAIL; NKR2B4; Nmrk; SLAMF4
Summary This gene encodes a cell surface receptor expressed on natural killer (NK) cells (and some T cells) that mediate non-major histocompatibility complex (MHC) restricted killing. The interaction between NK-cell and target cells via this receptor is thought to modulate NK-cell cytolytic activity. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Oct 2009]
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Natural killer cell mediated cytotoxicity
Write Your Own Review
You're reviewing:CD244 (NM_016382) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306988 CD244 MS Standard C13 and N15-labeled recombinant protein (NP_057466) 10 ug
$3,255.00
LC413990 CD244 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432954 CD244 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413990 Transient overexpression lysate of CD244 molecule, natural killer cell receptor 2B4 (CD244), transcript variant 1 100 ug
$436.00
LY432954 Transient overexpression lysate of CD244 molecule, natural killer cell receptor 2B4 (CD244), transcript variant 2 100 ug
$436.00
TP329806 Purified recombinant protein of Homo sapiens CD244 molecule, natural killer cell receptor 2B4 (CD244), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP723933 Human 2B4 Protein, mFc-His Tag 100 ug
$620.00
TP724012 Human 2B4 Protein, hFc tag 100 ug
$650.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.