OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Interleukin 34 (IL34) (NM_152456) Human Mass Spec Standard

Be the first to review this product
SKU
PH306629
IL34 MS Standard C13 and N15-labeled recombinant protein (NP_689669)
Size:
10 ug
  $3,360.00
2 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA811737 IL34 mouse monoclonal antibody,clone OTI5E1 100 ul
$447.00
LY403469 Transient overexpression lysate of interleukin 34 (IL34) (as WB positive control) 100 ug
$436.00

Other products for "Interleukin 34 or NM_152456"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206629
Predicted MW 27.5 kDa
Protein Sequence
Protein Sequence
>RC206629 protein sequence
Red=Cloning site Green=Tags(s)

MPRGFTWLRYLGIFLGVALGNEPLEMWPLTQNEECTVTGFLRDKLQYRSRLQYMKHYFPINYKISVPYEG
VFRIANVTRLQRAQVSERELRYLWVLVSLSATESVQDVLLEGHPSWKYLQEVQTLLLNVQQGLTDVEVSP
KVESVLSLLNAPGPNLKLVRPKALLDNCFRVMELLYCSCCKQSSVLNWQDCEVPSPQSCSPEPSLQYAAT
QLYPPPPWSPSSPPHSTGSVRPVRAQGEGLLP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_689669
RefSeq Size 1796
RefSeq ORF 726
Synonyms C16orf77; IL-34
Locus ID 146433
UniProt ID Q6ZMJ4
Cytogenetics 16q22.1
Summary Interleukin-34 is a cytokine that promotes the differentiation and viability of monocytes and macrophages through the colony-stimulating factor-1 receptor (CSF1R; MIM 164770) (Lin et al., 2008 PubMed 18467591).supplied by OMIM, May 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Interleukin 34" proteins (6)
SKU Description Size Price
LC403469 Lyophilized IL34 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432749 Lyophilized IL34 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403469 Transient overexpression lysate of interleukin 34 (IL34) (as WB positive control) 100 ug
$436.00
LY432749 Transient overexpression lysate of interleukin 34 (IL34), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP306629 Recombinant protein of human interleukin 34 (IL34), 20 µg 20 ug
$867.00
TP723763 Purified recombinant protein of Human interleukin 34 (IL34), transcript variant 1 10 ug
$465.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products