OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Interleukin 34 (IL34) (NM_152456) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP306629
Recombinant protein of human interleukin 34 (IL34), 20 µg
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA811737 IL34 mouse monoclonal antibody,clone OTI5E1
100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Interleukin 34 or NM_152456"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206629 protein sequence
Red=Cloning site Green=Tags(s)

MPRGFTWLRYLGIFLGVALGNEPLEMWPLTQNEECTVTGFLRDKLQYRSRLQYMKHYFPINYKISVPYEG
VFRIANVTRLQRAQVSERELRYLWVLVSLSATESVQDVLLEGHPSWKYLQEVQTLLLNVQQGLTDVEVSP
KVESVLSLLNAPGPNLKLVRPKALLDNCFRVMELLYCSCCKQSSVLNWQDCEVPSPQSCSPEPSLQYAAT
QLYPPPPWSPSSPPHSTGSVRPVRAQGEGLLP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 27.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_689669
Locus ID 146433
UniProt ID Q6ZMJ4
Cytogenetics 16q22.1
RefSeq Size 1796
RefSeq ORF 726
Synonyms C16orf77; IL-34
Summary Interleukin-34 is a cytokine that promotes the differentiation and viability of monocytes and macrophages through the colony-stimulating factor-1 receptor (CSF1R; MIM 164770) (Lin et al., 2008 PubMed 18467591).supplied by OMIM, May 2008
Protein Categories Cytokines, Growth Factors, Intracellular Proteins, Secreated Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Interleukin 34" proteins (6)
SKU Description Size Price
PH306629 IL34 MS Standard C13 and N15-labeled recombinant protein (NP_689669) 10 ug
$3,360.00
LC403469 Lyophilized IL34 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432749 Lyophilized IL34 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403469 Transient overexpression lysate of interleukin 34 (IL34) (as WB positive control) 100 ug
$436.00
LY432749 Transient overexpression lysate of interleukin 34 (IL34), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP723763 Purified recombinant protein of Human interleukin 34 (IL34), transcript variant 1 10 ug
$465.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products