Interleukin 34 (IL34) (NM_152456) Human Mass Spec Standard

SKU
PH306629
IL34 MS Standard C13 and N15-labeled recombinant protein (NP_689669)
$3,255.00
2 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206629]
Predicted MW 27.5 kDa
Protein Sequence
Protein Sequence
>RC206629 protein sequence
Red=Cloning site Green=Tags(s)

MPRGFTWLRYLGIFLGVALGNEPLEMWPLTQNEECTVTGFLRDKLQYRSRLQYMKHYFPINYKISVPYEG
VFRIANVTRLQRAQVSERELRYLWVLVSLSATESVQDVLLEGHPSWKYLQEVQTLLLNVQQGLTDVEVSP
KVESVLSLLNAPGPNLKLVRPKALLDNCFRVMELLYCSCCKQSSVLNWQDCEVPSPQSCSPEPSLQYAAT
QLYPPPPWSPSSPPHSTGSVRPVRAQGEGLLP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_689669
RefSeq Size 1796
RefSeq ORF 726
Synonyms C16orf77; IL-34
Locus ID 146433
UniProt ID Q6ZMJ4
Cytogenetics 16q22.1
Summary Interleukin-34 is a cytokine that promotes the differentiation and viability of monocytes and macrophages through the colony-stimulating factor-1 receptor (CSF1R; MIM 164770) (Lin et al., 2008 [PubMed 18467591]).[supplied by OMIM, May 2008]
Write Your Own Review
You're reviewing:Interleukin 34 (IL34) (NM_152456) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403469 IL34 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432749 IL34 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403469 Transient overexpression lysate of interleukin 34 (IL34) 100 ug
$436.00
LY432749 Transient overexpression lysate of interleukin 34 (IL34), transcript variant 2 100 ug
$436.00
TP306629 Recombinant protein of human interleukin 34 (IL34), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP723763 Purified recombinant protein of Human interleukin 34 (IL34), transcript variant 1 10 ug
$465.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.