OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD72 (NM_001782) Human Mass Spec Standard

Be the first to review this product
SKU
PH306609
CD72 MS Standard C13 and N15-labeled recombinant protein (NP_001773)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA354401 Rabbit anti CD72 Polyclonal Antibody
100 ug
$450.00
LY400673 Transient overexpression lysate of CD72 molecule (CD72) (as WB positive control) 100 ug
$436.00

Other products for "CD72 or NM_001782"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206609
Predicted MW 40.2 kDa
Protein Sequence
Protein Sequence
>RC206609 protein sequence
Red=Cloning site Green=Tags(s)

MAEAITYADLRFVKAPLKKSISSRLGQDPGADDDGEITYENVQVPAVLGVPSSLASSVLGDKAAVKSEQP
TASWRAVTSPAVGRILPCRTTCLRYLLLGLLLTCLLLGVTAICLGVRYLQVSQQLQQTNRVLEVTNSSLR
QQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALE
QKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHS
YYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYIC
EMTAFRFPD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001773
RefSeq Size 1548
RefSeq ORF 1077
Synonyms CD72b; LYB2
Locus ID 971
UniProt ID P21854
Cytogenetics 9p13.3
Summary Plays a role in B-cell proliferation and differentiation.UniProtKB/Swiss-Prot Function
Protein Families Adult stem cells, Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways B cell receptor signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CD72" proteins (5)
SKU Description Size Price
LC400673 Lyophilized CD72 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400673 Transient overexpression lysate of CD72 molecule (CD72) (as WB positive control) 100 ug
$436.00
TP306609 Recombinant protein of human CD72 molecule (CD72), 20 µg 20 ug
$867.00
TP700240 Purified recombinant protein of human CD72 molecule (CD72), with C-terminal DDK/His tag, expressed in human cells, 20 µg 20 ug
$900.00
TP720875 Purified recombinant protein of Human CD72 molecule (CD72) 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products