CD247 (NM_000734) Human Mass Spec Standard
CAT#: PH306562
CD247 MS Standard C13 and N15-labeled recombinant protein (NP_000725)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206562 |
Predicted MW | 18.7 kDa |
Protein Sequence |
>RC206562 protein sequence
Red=Cloning site Green=Tags(s) MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQ LYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDG LYQGLSTATKDTYDALHMQALPPR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000725 |
RefSeq Size | 1687 |
RefSeq ORF | 492 |
Synonyms | CD3-ZETA; CD3H; CD3Q; CD3Z; IMD25; T3Z; TCRZ |
Locus ID | 919 |
UniProt ID | P20963 |
Cytogenetics | 1q24.2 |
Summary | The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Natural killer cell mediated cytotoxicity, T cell receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403667 | CD247 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC424538 | CD247 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY403667 | Transient overexpression lysate of CD247 molecule (CD247), transcript variant 1 |
USD 436.00 |
|
LY424538 | Transient overexpression lysate of CD247 molecule (CD247), transcript variant 2 |
USD 436.00 |
|
PH314725 | CD247 MS Standard C13 and N15-labeled recombinant protein (NP_932170) |
USD 3,255.00 |
|
TP306562 | Recombinant protein of human CD247 molecule (CD247), transcript variant 2, 20 µg |
USD 867.00 |
|
TP314725 | Recombinant protein of human CD247 molecule (CD247), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review