CD247 (NM_198053) Human Recombinant Protein

SKU
TP314725
Recombinant protein of human CD247 molecule (CD247), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC214725 representing NM_198053
Red=Cloning site Green=Tags(s)

MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQ
LYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGL
YQGLSTATKDTYDALHMQALPPR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 16.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_932170
Locus ID 919
UniProt ID P20963
Cytogenetics 1q24.2
RefSeq Size 1677
RefSeq ORF 489
Synonyms CD3-ZETA; CD3H; CD3Q; CD3Z; IMD25; T3Z; TCRZ
Summary The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Natural killer cell mediated cytotoxicity, T cell receptor signaling pathway
Write Your Own Review
You're reviewing:CD247 (NM_198053) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306562 CD247 MS Standard C13 and N15-labeled recombinant protein (NP_000725) 10 ug
$3,255.00
PH314725 CD247 MS Standard C13 and N15-labeled recombinant protein (NP_932170) 10 ug
$3,255.00
LC403667 CD247 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424538 CD247 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403667 Transient overexpression lysate of CD247 molecule (CD247), transcript variant 1 100 ug
$436.00
LY424538 Transient overexpression lysate of CD247 molecule (CD247), transcript variant 2 100 ug
$436.00
TP306562 Recombinant protein of human CD247 molecule (CD247), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.