OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD247 (NM_000734) Human Mass Spec Standard

Be the first to review this product
SKU
PH306562
CD247 MS Standard C13 and N15-labeled recombinant protein (NP_000725)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY403667 Transient overexpression lysate of CD247 molecule (CD247), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "CD247 or NM_000734"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206562
Predicted MW 18.7 kDa
Protein Sequence
Protein Sequence
>RC206562 protein sequence
Red=Cloning site Green=Tags(s)

MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQ
LYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDG
LYQGLSTATKDTYDALHMQALPPR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000725
RefSeq Size 1687
RefSeq ORF 492
Synonyms CD3-ZETA; CD3H; CD3Q; CD3Z; IMD25; T3Z; TCRZ
Locus ID 919
UniProt ID P20963
Cytogenetics 1q24.2
Summary The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Transmembrane
Protein Pathways Natural killer cell mediated cytotoxicity, T cell receptor signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CD247" proteins (7)
SKU Description Size Price
PH314725 CD247 MS Standard C13 and N15-labeled recombinant protein (NP_932170) 10 ug
$3,360.00
LC403667 Lyophilized CD247 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424538 Lyophilized CD247 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403667 Transient overexpression lysate of CD247 molecule (CD247), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY424538 Transient overexpression lysate of CD247 molecule (CD247), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP306562 Recombinant protein of human CD247 molecule (CD247), transcript variant 2, 20 µg 20 ug
$737.00
TP314725 Recombinant protein of human CD247 molecule (CD247), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products