CD247 (NM_000734) Human Mass Spec Standard

SKU
PH306562
CD247 MS Standard C13 and N15-labeled recombinant protein (NP_000725)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206562]
Predicted MW 18.7 kDa
Protein Sequence
Protein Sequence
>RC206562 protein sequence
Red=Cloning site Green=Tags(s)

MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQ
LYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDG
LYQGLSTATKDTYDALHMQALPPR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000725
RefSeq Size 1687
RefSeq ORF 492
Synonyms CD3-ZETA; CD3H; CD3Q; CD3Z; IMD25; T3Z; TCRZ
Locus ID 919
UniProt ID P20963
Cytogenetics 1q24.2
Summary The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Natural killer cell mediated cytotoxicity, T cell receptor signaling pathway
Write Your Own Review
You're reviewing:CD247 (NM_000734) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH314725 CD247 MS Standard C13 and N15-labeled recombinant protein (NP_932170) 10 ug
$3,255.00
LC403667 CD247 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424538 CD247 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403667 Transient overexpression lysate of CD247 molecule (CD247), transcript variant 1 100 ug
$436.00
LY424538 Transient overexpression lysate of CD247 molecule (CD247), transcript variant 2 100 ug
$436.00
TP306562 Recombinant protein of human CD247 molecule (CD247), transcript variant 2, 20 µg 20 ug
$737.00
TP314725 Recombinant protein of human CD247 molecule (CD247), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.