OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CGREF1 (NM_006569) Human Mass Spec Standard

Be the first to review this product
SKU
PH306520
CGREF1 MS Standard C13 and N15-labeled recombinant protein (NP_006560)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA365633 CGREF1 rabbit polyclonal antibody
100 ul
$310.00
LY416558 Transient overexpression lysate of cell growth regulator with EF-hand domain 1 (CGREF1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "CGREF1 or NM_006569"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206520
Predicted MW 31.9 kDa
Protein Sequence
Protein Sequence
>RC206520 protein sequence
Red=Cloning site Green=Tags(s)

MLPLTMTVLILLLLPTGQAAPKDGVTRPDSEVQHQLLPNPFQPGQEQLGLLQSYLKGLGRTEVQLEHLSR
EQVLLYLFALHDYDQSGQLDGLELLSMLTAALAPGAANSPTTNPVILIVDKVLETQDLNGDGLMTPAELI
NFPGVALRHVEPGEPLAPSPQEPQAVGRQSLLAKSPLRQETQEAPGPREEAKGQVEARRESLDPVQEPGG
QAEADGDVPGPRGEAEGQAEAKGDAPGPRGEAGGQAEAEGDAPGPRGEAGGQAEARENGEEAKELPGETL
ESKNTQNDFEVHIVQVENDEI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006560
RefSeq Size 1934
RefSeq ORF 903
Synonyms CGR11
Locus ID 10669
UniProt ID Q99674
Cytogenetics 2p23.3
Summary Mediates cell-cell adhesion in a calcium-dependent manner (By similarity). Able to inhibit growth in several cell lines.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CGREF1" proteins (3)
SKU Description Size Price
LC416558 Lyophilized CGREF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416558 Transient overexpression lysate of cell growth regulator with EF-hand domain 1 (CGREF1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP306520 Recombinant protein of human cell growth regulator with EF-hand domain 1 (CGREF1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products