CGREF1 (NM_006569) Human Recombinant Protein

SKU
TP306520
Recombinant protein of human cell growth regulator with EF-hand domain 1 (CGREF1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206520 protein sequence
Red=Cloning site Green=Tags(s)

MLPLTMTVLILLLLPTGQAAPKDGVTRPDSEVQHQLLPNPFQPGQEQLGLLQSYLKGLGRTEVQLEHLSR
EQVLLYLFALHDYDQSGQLDGLELLSMLTAALAPGAANSPTTNPVILIVDKVLETQDLNGDGLMTPAELI
NFPGVALRHVEPGEPLAPSPQEPQAVGRQSLLAKSPLRQETQEAPGPREEAKGQVEARRESLDPVQEPGG
QAEADGDVPGPRGEAEGQAEAKGDAPGPRGEAGGQAEAEGDAPGPRGEAGGQAEARENGEEAKELPGETL
ESKNTQNDFEVHIVQVENDEI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 33.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006560
Locus ID 10669
UniProt ID Q99674
Cytogenetics 2p23.3
RefSeq Size 1934
RefSeq ORF 903
Synonyms CGR11
Summary Mediates cell-cell adhesion in a calcium-dependent manner (By similarity). Able to inhibit growth in several cell lines.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:CGREF1 (NM_006569) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306520 CGREF1 MS Standard C13 and N15-labeled recombinant protein (NP_006560) 10 ug
$3,255.00
LC416558 CGREF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416558 Transient overexpression lysate of cell growth regulator with EF-hand domain 1 (CGREF1), transcript variant 1 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.