OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

AXL (NM_021913) Human Mass Spec Standard

Be the first to review this product
SKU
PH306431
AXL MS Standard C13 and N15-labeled recombinant protein (NP_068713)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA373880 Axl Rabbit polyclonal Antibody
100 ul
$410.00
LY411883 Transient overexpression lysate of AXL receptor tyrosine kinase (AXL), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "AXL or NM_021913"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206431
Predicted MW 98.2 kDa
Protein Sequence
Protein Sequence
>RC206431 representing NM_021913
Red=Cloning site Green=Tags(s)

MAWRCPRMGRVPLAWCLALCGWACMAPRGTQAEESPFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWL
RDGQILELADSTQTQVPLGEDEQDDWIVVSQLRITSLQLSDTGQYQCLVFLGHQTFVSQPGYVGLEGLPY
FLEEPEDRTVAANTPFNLSCQAQGPPEPVDLLWLQDAVPLATAPGHGPQRSLHVPGLNKTSSFSCEAHNA
KGVTTSRTATITVLPQQPRNLHLVSRQPTELEVAWTPGLSGIYPLTHCTLQAVLSDDGMGIQAGEPDPPE
EPLTSQASVPPHQLRLGSLHPHTPYHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISATRNGSQAF
VHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLELQGDGSVSNLTVCVAAYTAAGDGPWSLP
VPLEAWRPGQAQPVHQLVKEPSTPAFSWPWWYVLLGAVVAAACVLILALFLVHRRKKETRYGEVFEPTVE
RGELVVRYRVRKSYSRRTTEATLNSLGISEELKEKLRDVMVDRHKVALGKTLGEGEFGAVMEGQLNQDDS
ILKVAVKTMKIAICTRSELEDFLSEAVCMKEFDHPNVMRLIGVCFQGSERESFPAPVVILPFMKHGDLHS
FLLYSRLGDQPVYLPTQMLVKFMADIASGMEYLSTKRFIHRDLAARNCMLNENMSVCVADFGLSKKIYNG
DYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWSFGVTMWEIATRGQTPYPGVENSEIYDYLRRGNRLKQ
PADCLDGLYALMSRCWELNPQDRPSFTELREDLENTLKALPPAQEPDEILYVNMDEGGGYPEPPGAAGGA
DPPTQPDPKDSCSCLTAAEVHPAGRYVLCPSTTPSPAQPADRGSPAAPGQEDGA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_068713
RefSeq Size 5014
RefSeq ORF 2682
Synonyms ARK; JTK11; Tyro7; UFO
Locus ID 558
UniProt ID P30530
Cytogenetics 19q13.2
Summary The protein encoded by this gene is a member of the Tyro3-Axl-Mer (TAM) receptor tyrosine kinase subfamily. The encoded protein possesses an extracellular domain which is composed of two immunoglobulin-like motifs at the N-terminal, followed by two fibronectin type-III motifs. It transduces signals from the extracellular matrix into the cytoplasm by binding to the vitamin K-dependent protein growth arrest-specific 6 (Gas6). This gene may be involved in several cellular functions including growth, migration, aggregation and anti-inflammation in multiple cell types. Alternative splicing results in multiple transcript variants of this gene. provided by RefSeq, Jul 2013
Protein Families Druggable Genome, Protein Kinase, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "AXL" proteins (6)
SKU Description Size Price
LC411883 Lyophilized AXL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411883 Transient overexpression lysate of AXL receptor tyrosine kinase (AXL), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP306431 Recombinant protein of human AXL receptor tyrosine kinase (AXL), transcript variant 1, 20 µg 20 ug
$737.00
TP700172 Purified recombinant protein of human AXL receptor tyrosine kinase(AXL), transcript variant 1, with C-terminal DDK/His tag, expressed in human cells, 20 µg 20 ug
$900.00
TP700173 Purified recombinant protein of human AXL receptor tyrosine kinase(AXL), transcript variant 2, with C-terminal DDK/His tag, expressed in human cells, 20 µg 20 ug
$900.00
TP723978 Recombinant human AXL protein with C-terminal 6×His tag 100 ug
$795.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products