OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ACBD7 (NM_001039844) Human Mass Spec Standard

Be the first to review this product
SKU
PH306332
ACBD7 MS Standard C13 and N15-labeled recombinant protein (NP_001034933)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA335984 Rabbit Polyclonal Anti-PALM Antibody
100 ul
$585.00
LY421837 Transient overexpression lysate of acyl-Coenzyme A binding domain containing 7 (ACBD7) (as WB positive control) 100 ug
$436.00

Other products for "ACBD7 or NM_001039844"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206332
Predicted MW 9.8 kDa
Protein Sequence
Protein Sequence
>RC206332 protein sequence
Red=Cloning site Green=Tags(s)

MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTED
ATSAYISKAKELIEKYGI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001034933
RefSeq Size 3383
RefSeq ORF 264
Synonyms bA455B2.2
Locus ID 414149
UniProt ID Q8N6N7
Cytogenetics 10p13
Summary Binds medium- and long-chain acyl-CoA esters.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ACBD7" proteins (3)
SKU Description Size Price
LC421837 Lyophilized ACBD7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY421837 Transient overexpression lysate of acyl-Coenzyme A binding domain containing 7 (ACBD7) (as WB positive control) 100 ug
$436.00
TP306332 Recombinant protein of human acyl-Coenzyme A binding domain containing 7 (ACBD7), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products