ACBD7 Rabbit Polyclonal Antibody

SKU TA335984

Rabbit Polyclonal Anti-PALM Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PALM Antibody: synthetic peptide directed towards the N terminal of human PALM. Synthetic peptide located within the following region: LEDERRQLQHLKSKALRERWLLEGTPSSASEGDEDLRRQMQDDEQKTRLL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 37 kDa
• Gene Name: acyl-CoA binding domain containing 7
• Database Link:
  NP_001034933
  Q8N6N7
• Background: This gene encodes a member of the paralemmin protein family. The product of this gene is a prenylated and palmitoylated phosphoprotein that associates with the cytoplasmic face of plasma membranes and is implicated in plasma membrane dynamics in neurons and other cell types. Several alternatively spliced transcript variants have been identified, but the full-length nature of only two transcript variants has been determined.
• Synonyms: bA455B2.2
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Bovine: 93%; Pig: 86%; Mouse: 86%; Dog: 79%; Rabbit: 79%

Reference Data