OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TC2N (NM_152332) Human Mass Spec Standard

Be the first to review this product
SKU
PH306331
TC2N MS Standard C13 and N15-labeled recombinant protein (NP_689545)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA338817 Rabbit Polyclonal Anti-TC2N Antibody
100 ul
$585.00
LY403463 Transient overexpression lysate of tandem C2 domains, nuclear (TC2N), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "TC2N or NM_152332"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206331
Predicted MW 55.3 kDa
Protein Sequence
Protein Sequence
>RC206331 protein sequence
Red=Cloning site Green=Tags(s)

MATEFIKSCCGGCFYGETEKHNFSVERDFKAAVPNSQNATISVPPLTSVSVKPQLGCTEDYLLSKLPSDG
KEVPFVVPKFKLSYIQPRTQETPSHLEELEGSARASFGDRKVELSSSSQHGPSYDVYNPFYMYQHISPDL
SRRFPPRSEVTRLYGSVCDLRTNKLPGSPGLSKSMFDLTNSSQRFIQRHDSLSSVPSSSSSRKNSQGSNR
SLDTITLSGDERDFGRLNVKLFYNSSVEQIWITVLQCRDLSWPSSYGDTPTVSIKGILTLPKPVHFKSSA
KEGSNAIEFMETFVFAIKLQNLQTVRLVFKIQTQTPRKKTIGECSMSLRTLSTQEMDYSLDITPPSKISV
CHAELELGTCFQAVNSRIQLQILEARYLPSSSTPLTLSFFVKVGMFSSGELIYKKKTRLLKASNGRVKWG
ETMIFPLIQSEKEIVFLIKLYSRSSVRRKHFVGQIWISEDSNNIEAVNQWKETVINPEKVVIRWHKLNPS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_689545
RefSeq Size 5222
RefSeq ORF 1470
Synonyms C2CD1; C14orf47; MTAC2D1; Tac2-N
Locus ID 123036
UniProt ID Q8N9U0
Cytogenetics 14q32.12
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TC2N" proteins (7)
SKU Description Size Price
LC403463 Lyophilized TC2N HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426966 Lyophilized TC2N HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426967 Lyophilized TC2N HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403463 Transient overexpression lysate of tandem C2 domains, nuclear (TC2N), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY426966 Transient overexpression lysate of tandem C2 domains, nuclear (TC2N), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY426967 Transient overexpression lysate of tandem C2 domains, nuclear (TC2N), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP306331 Recombinant protein of human tandem C2 domains, nuclear (TC2N), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products