VSTM2A (NM_182546) Human Mass Spec Standard

CAT#: PH306198

VSTM2A MS Standard C13 and N15-labeled recombinant protein (NP_872352)

Product Images

Coomassie blue staining of purified VSTM2A protein (Cat# TP306198). The protein was produced from HEK293T cells transfected with VSTM2A cDNA clone (Cat# RC206198) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206198
• Predicted MW: 27 kDa
• Protein Sequence:
  Sequence Link

  >RC206198 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGIFLVYVGFVFFSVLYVQQGLSSQAKFTEFPRNVTATEGQNVEMSCAFQSGSASVYLEIQWWFLRGPED
  LDPGAEGAGAQVKLLPDRDPDSDGTKISTVKVQGNDISHKLQISKVRKKDEGLYECRVTDANYGELQEHK
  AQAYLKVNANSHARRMQAFEASPMWLQDMKPRKNVSAAIPSSIHGSANQRTHSTSSPQVVAKIPKQSPQS
  GMETHFEPFILPLTNAPQKGQSYRVDRFMNGDF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_872352
• RefSeq Size: 3122
• RefSeq ORF: 729
• Synonyms: VSTM2
• Locus ID: 222008
• UniProt ID: Q8TAG5
• Cytogenetics: 7p11.2
• Summary: Plays a role in the regulation of the early stage of white and brown preadipocyte cell differentiation. Promotes adipogenic commitment of preadipocytes by increasing gene expression of the transcription factor PPARG in a BMP4-dependent signaling pathway.[UniProtKB/Swiss-Prot Function]
• Protein Families: Secreted Protein, Transmembrane