VSTM2A (NM_182546) Human Recombinant Protein

SKU
TP306198
Recombinant protein of human V-set and transmembrane domain containing 2A (VSTM2A), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206198 protein sequence
Red=Cloning site Green=Tags(s)

MGIFLVYVGFVFFSVLYVQQGLSSQAKFTEFPRNVTATEGQNVEMSCAFQSGSASVYLEIQWWFLRGPED
LDPGAEGAGAQVKLLPDRDPDSDGTKISTVKVQGNDISHKLQISKVRKKDEGLYECRVTDANYGELQEHK
AQAYLKVNANSHARRMQAFEASPMWLQDMKPRKNVSAAIPSSIHGSANQRTHSTSSPQVVAKIPKQSPQS
GMETHFEPFILPLTNAPQKGQSYRVDRFMNGDF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 25.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_872352
Locus ID 222008
UniProt ID Q8TAG5
Cytogenetics 7p11.2
RefSeq Size 3122
RefSeq ORF 729
Synonyms VSTM2
Summary Plays a role in the regulation of the early stage of white and brown preadipocyte cell differentiation. Promotes adipogenic commitment of preadipocytes by increasing gene expression of the transcription factor PPARG in a BMP4-dependent signaling pathway.[UniProtKB/Swiss-Prot Function]
Protein Families Secreted Protein, Transmembrane
Write Your Own Review
You're reviewing:VSTM2A (NM_182546) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306198 VSTM2A MS Standard C13 and N15-labeled recombinant protein (NP_872352) 10 ug
$3,255.00
LC405498 VSTM2A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405498 Transient overexpression lysate of V-set and transmembrane domain containing 2A (VSTM2A) 100 ug
$436.00
TP721227 Purified recombinant protein of Human V-set and transmembrane domain containing 2A (VSTM2A) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.