DIRAS1 (NM_145173) Human Mass Spec Standard

CAT#: PH306160

DIRAS1 MS Standard C13 and N15-labeled recombinant protein (NP_660156)

Product Images

Coomassie blue staining of purified DIRAS1 protein (Cat# TP306160). The protein was produced from HEK293T cells transfected with DIRAS1 cDNA clone (Cat# RC206160) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206160
• Predicted MW: 22.3 kDa
• Protein Sequence:
  Sequence Link

  >RC206160 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPA
  MQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQ
  EWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKGKCTLM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_660156
• RefSeq Size: 3412
• RefSeq ORF: 594
• Synonyms: Di-Ras1; GBTS1; RIG
• Locus ID: 148252
• UniProt ID: O95057
• Cytogenetics: 19p13.3
• Summary: DIRAS1 belongs to a distinct branch of the functionally diverse Ras (see HRAS; MIM 190020) superfamily of monomeric GTPases.[supplied by OMIM, Apr 2004]