OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DIRAS1 (NM_145173) Human Mass Spec Standard

Be the first to review this product
SKU
PH306160
DIRAS1 MS Standard C13 and N15-labeled recombinant protein (NP_660156)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA351142 Rabbit Polyclonal Anti-DIRAS1 Antibody
100 ul
$205.00
LY408035 Transient overexpression lysate of DIRAS family, GTP-binding RAS-like 1 (DIRAS1) (as WB positive control) 100 ug
$436.00

Other products for "DIRAS1 or NM_145173"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206160
Predicted MW 22.3 kDa
Protein Sequence
Protein Sequence
>RC206160 protein sequence
Red=Cloning site Green=Tags(s)

MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPA
MQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQ
EWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKGKCTLM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_660156
RefSeq Size 3412
RefSeq ORF 594
Synonyms Di-Ras1; GBTS1; RIG
Locus ID 148252
UniProt ID O95057
Cytogenetics 19p13.3
Summary DIRAS1 belongs to a distinct branch of the functionally diverse Ras (see HRAS; MIM 190020) superfamily of monomeric GTPases.supplied by OMIM, Apr 2004
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DIRAS1" proteins (3)
SKU Description Size Price
LC408035 Lyophilized DIRAS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408035 Transient overexpression lysate of DIRAS family, GTP-binding RAS-like 1 (DIRAS1) (as WB positive control) 100 ug
$436.00
TP306160 Recombinant protein of human DIRAS family, GTP-binding RAS-like 1 (DIRAS1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products