DIRAS1 (NM_145173) Human Recombinant Protein

SKU
TP306160
Recombinant protein of human DIRAS family, GTP-binding RAS-like 1 (DIRAS1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206160 protein sequence
Red=Cloning site Green=Tags(s)

MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPA
MQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQ
EWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKGKCTLM

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 22.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_660156
Locus ID 148252
UniProt ID O95057
Cytogenetics 19p13.3
RefSeq Size 3412
RefSeq ORF 594
Synonyms Di-Ras1; GBTS1; RIG
Summary DIRAS1 belongs to a distinct branch of the functionally diverse Ras (see HRAS; MIM 190020) superfamily of monomeric GTPases.[supplied by OMIM, Apr 2004]
Write Your Own Review
You're reviewing:DIRAS1 (NM_145173) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306160 DIRAS1 MS Standard C13 and N15-labeled recombinant protein (NP_660156) 10 ug
$3,255.00
LC408035 DIRAS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408035 Transient overexpression lysate of DIRAS family, GTP-binding RAS-like 1 (DIRAS1) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.