OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PMP2 (NM_002677) Human Mass Spec Standard

Be the first to review this product
SKU
PH306053
PMP2 MS Standard C13 and N15-labeled recombinant protein (NP_002668)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA369278 PMP2 rabbit polyclonal antibody
100 ul
$310.00
LY400948 Transient overexpression lysate of peripheral myelin protein 2 (PMP2) (as WB positive control) 100 ug
$436.00

Other products for "PMP2 or NM_002677"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206053
Predicted MW 14.9 kDa
Protein Sequence
Protein Sequence
>RC206053 protein sequence
Red=Cloning site Green=Tags(s)

MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQE
FEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002668
RefSeq Size 3579
RefSeq ORF 396
Synonyms CMT1G; FABP8; M-FABP; MP2; P2
Locus ID 5375
UniProt ID P02689
Cytogenetics 8q21.13
Summary The protein encoded by this gene localizes to myelin sheaths of the peripheral nervous system. The encoded protein can bind both the membrane layers of the sheaths and monomeric lipids, and is thought to provide stability to the sheath. A defect in this gene was shown to be a cause of dominant demyelinating CMT neuropathy. provided by RefSeq, Jan 2017
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PMP2" proteins (4)
SKU Description Size Price
LC400948 Lyophilized PMP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400948 Transient overexpression lysate of peripheral myelin protein 2 (PMP2) (as WB positive control) 100 ug
$436.00
TP306053 Recombinant protein of human peripheral myelin protein 2 (PMP2), 20 µg 20 ug
$867.00
TP720618 Purified recombinant protein of Human peripheral myelin protein 2 (PMP2) 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products