PMP2 (NM_002677) Human Recombinant Protein

SKU
TP306053
Recombinant protein of human peripheral myelin protein 2 (PMP2), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206053 protein sequence
Red=Cloning site Green=Tags(s)

MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQE
FEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 14.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002668
Locus ID 5375
UniProt ID P02689
Cytogenetics 8q21.13
RefSeq Size 3579
RefSeq ORF 396
Synonyms CMT1G; FABP8; M-FABP; MP2; P2
Summary The protein encoded by this gene localizes to myelin sheaths of the peripheral nervous system. The encoded protein can bind both the membrane layers of the sheaths and monomeric lipids, and is thought to provide stability to the sheath. A defect in this gene was shown to be a cause of dominant demyelinating CMT neuropathy. [provided by RefSeq, Jan 2017]
Write Your Own Review
You're reviewing:PMP2 (NM_002677) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306053 PMP2 MS Standard C13 and N15-labeled recombinant protein (NP_002668) 10 ug
$3,255.00
LC400948 PMP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400948 Transient overexpression lysate of peripheral myelin protein 2 (PMP2) 100 ug
$436.00
TP720618 Purified recombinant protein of Human peripheral myelin protein 2 (PMP2) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.