PIP4K2C (NM_024779) Human Mass Spec Standard

CAT#: PH305976

PIP4K2C MS Standard C13 and N15-labeled recombinant protein (NP_079055)

Product Images

Coomassie blue staining of purified PIP4K2C protein (Cat# TP305976). The protein was produced from HEK293T cells transfected with PIP4K2C cDNA clone (Cat# RC205976) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205976
• Predicted MW: 47.3 kDa
• Protein Sequence:
  Sequence Link

  >RC205976 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASSSVPPATVSAATAGPGPGFGFASKTKKKHFVQQKVKVFRAADPLVGVFLWGVAHSINELSQVPPPVM
  LLPDDFKASSKIKVNNHLFHRENLPSHFKFKEYCPQVFRNLRDRFGIDDQDYLVSLTRNPPSESEGSDGR
  FLISYDRTLVIKEVSSEDIADMHSNLSNYHQYIVKCHGNTLLPQFLGMYRVSVDNEDSYMLVMRNMFSHR
  LPVHRKYDLKGSLVSREASDKEKVKELPTLRDMDFLNKNQKVYIGEEEKKIFLEKLKRDVEFLVQLKIMD
  YSLLLGIHDIIRGSEPEEEAPVREDESEVDGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESF
  IDVYAIRSAEGAPQKEVYFMGLIDILTQYDAKKKAAHAAKTVKHGAGAEISTVHPEQYAKRFLDFITNIF
  A
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_079055
• RefSeq Size: 3229
• RefSeq ORF: 1263
• Synonyms: PIP5K2C
• Locus ID: 79837
• UniProt ID: Q8TBX8
• Cytogenetics: 12q13.3
• Summary: May play an important role in the production of Phosphatidylinositol bisphosphate (PIP2), in the endoplasmic reticulum.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome
• Protein Pathways: Inositol phosphate metabolism, Phosphatidylinositol signaling system, Regulation of actin cytoskeleton