PIP4K2C (NM_024779) Human Recombinant Protein
SKU
TP305976
Recombinant protein of human phosphatidylinositol-5-phosphate 4-kinase, type II, gamma (PIP4K2C), 20 µg
$737.00
4 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC205976 protein sequence
Red=Cloning site Green=Tags(s) MASSSVPPATVSAATAGPGPGFGFASKTKKKHFVQQKVKVFRAADPLVGVFLWGVAHSINELSQVPPPVM LLPDDFKASSKIKVNNHLFHRENLPSHFKFKEYCPQVFRNLRDRFGIDDQDYLVSLTRNPPSESEGSDGR FLISYDRTLVIKEVSSEDIADMHSNLSNYHQYIVKCHGNTLLPQFLGMYRVSVDNEDSYMLVMRNMFSHR LPVHRKYDLKGSLVSREASDKEKVKELPTLRDMDFLNKNQKVYIGEEEKKIFLEKLKRDVEFLVQLKIMD YSLLLGIHDIIRGSEPEEEAPVREDESEVDGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESF IDVYAIRSAEGAPQKEVYFMGLIDILTQYDAKKKAAHAAKTVKHGAGAEISTVHPEQYAKRFLDFITNIF A myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 47.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_079055 |
Locus ID | 79837 |
UniProt ID | Q8TBX8 |
Cytogenetics | 12q13.3 |
RefSeq Size | 3229 |
RefSeq ORF | 1263 |
Synonyms | PIP5K2C |
Summary | May play an important role in the production of Phosphatidylinositol bisphosphate (PIP2), in the endoplasmic reticulum.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Protein Pathways | Inositol phosphate metabolism, Phosphatidylinositol signaling system, Regulation of actin cytoskeleton |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH305976 | PIP4K2C MS Standard C13 and N15-labeled recombinant protein (NP_079055) | 10 ug |
$3,255.00
|
|
LC411069 | PIP4K2C HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC431328 | PIP4K2C HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC431351 | PIP4K2C HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC431365 | PIP4K2C HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY411069 | Transient overexpression lysate of phosphatidylinositol-5-phosphate 4-kinase, type II, gamma (PIP4K2C), transcript variant 1 | 100 ug |
$436.00
|
|
LY431328 | Transient overexpression lysate of phosphatidylinositol-5-phosphate 4-kinase, type II, gamma (PIP4K2C), transcript variant 4 | 100 ug |
$436.00
|
|
LY431351 | Transient overexpression lysate of phosphatidylinositol-5-phosphate 4-kinase, type II, gamma (PIP4K2C), transcript variant 3 | 100 ug |
$436.00
|
|
LY431365 | Transient overexpression lysate of phosphatidylinositol-5-phosphate 4-kinase, type II, gamma (PIP4K2C), transcript variant 2 | 100 ug |
$436.00
|
|
TP328337 | Recombinant protein of human phosphatidylinositol-5-phosphate 4-kinase, type II, gamma (PIP4K2C), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.