PIP4K2C (NM_024779) Human Mass Spec Standard

SKU
PH305976
PIP4K2C MS Standard C13 and N15-labeled recombinant protein (NP_079055)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205976]
Predicted MW 47.3 kDa
Protein Sequence
Protein Sequence
>RC205976 protein sequence
Red=Cloning site Green=Tags(s)

MASSSVPPATVSAATAGPGPGFGFASKTKKKHFVQQKVKVFRAADPLVGVFLWGVAHSINELSQVPPPVM
LLPDDFKASSKIKVNNHLFHRENLPSHFKFKEYCPQVFRNLRDRFGIDDQDYLVSLTRNPPSESEGSDGR
FLISYDRTLVIKEVSSEDIADMHSNLSNYHQYIVKCHGNTLLPQFLGMYRVSVDNEDSYMLVMRNMFSHR
LPVHRKYDLKGSLVSREASDKEKVKELPTLRDMDFLNKNQKVYIGEEEKKIFLEKLKRDVEFLVQLKIMD
YSLLLGIHDIIRGSEPEEEAPVREDESEVDGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESF
IDVYAIRSAEGAPQKEVYFMGLIDILTQYDAKKKAAHAAKTVKHGAGAEISTVHPEQYAKRFLDFITNIF
A

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079055
RefSeq Size 3229
RefSeq ORF 1263
Synonyms PIP5K2C
Locus ID 79837
UniProt ID Q8TBX8
Cytogenetics 12q13.3
Summary May play an important role in the production of Phosphatidylinositol bisphosphate (PIP2), in the endoplasmic reticulum.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome
Protein Pathways Inositol phosphate metabolism, Phosphatidylinositol signaling system, Regulation of actin cytoskeleton
Write Your Own Review
You're reviewing:PIP4K2C (NM_024779) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411069 PIP4K2C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431328 PIP4K2C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431351 PIP4K2C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431365 PIP4K2C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411069 Transient overexpression lysate of phosphatidylinositol-5-phosphate 4-kinase, type II, gamma (PIP4K2C), transcript variant 1 100 ug
$436.00
LY431328 Transient overexpression lysate of phosphatidylinositol-5-phosphate 4-kinase, type II, gamma (PIP4K2C), transcript variant 4 100 ug
$436.00
LY431351 Transient overexpression lysate of phosphatidylinositol-5-phosphate 4-kinase, type II, gamma (PIP4K2C), transcript variant 3 100 ug
$436.00
LY431365 Transient overexpression lysate of phosphatidylinositol-5-phosphate 4-kinase, type II, gamma (PIP4K2C), transcript variant 2 100 ug
$436.00
TP305976 Recombinant protein of human phosphatidylinositol-5-phosphate 4-kinase, type II, gamma (PIP4K2C), 20 µg 20 ug
$737.00
TP328337 Recombinant protein of human phosphatidylinositol-5-phosphate 4-kinase, type II, gamma (PIP4K2C), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.