OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ERp57 (PDIA3) (NM_005313) Human Mass Spec Standard

Be the first to review this product
SKU
PH305940
PDIA3 MS Standard C13 and N15-labeled recombinant protein (NP_005304)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA504995 PDIA3 (ERp57) mouse monoclonal antibody, clone OTI3E1 (formerly 3E1) 100 ul
$447.00
LY401637 Transient overexpression lysate of protein disulfide isomerase family A, member 3 (PDIA3) (as WB positive control) 100 ug
$436.00

Other products for "ERp57 or NM_005313"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205940
Predicted MW 56.78 kDa
Protein Sequence
Protein Sequence
>RC205940 representing NM_005313
Red=Cloning site Green=Tags(s)

MRLRRLALFPGVALLLAAARLAAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKRLAPEYEAA
ATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLR
TEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSH
LTNKFEDKTVAYTEQKMTSGKIKKFIQENIFGICPHMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYWR
NRVMMVAKKFLDAGHKLNFAVASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALE
RFLQDYFDGNLKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELG
EKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQREATNPPVI
QEEKPKKKKKAQEDL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005304
RefSeq Size 3060
RefSeq ORF 1515
Synonyms ER60; ERp57; ERp60; ERp61; GRP57; GRP58; HEL-S-93n; HEL-S-269; HsT17083; P58; PI-PLC
Locus ID 2923
UniProt ID P30101
Cytogenetics 15q15.3
Summary This gene encodes a protein of the endoplasmic reticulum that interacts with lectin chaperones calreticulin and calnexin to modulate folding of newly synthesized glycoproteins. The protein was once thought to be a phospholipase; however, it has been demonstrated that the protein actually has protein disulfide isomerase activity. It is thought that complexes of lectins and this protein mediate protein folding by promoting formation of disulfide bonds in their glycoprotein substrates. This protein also functions as a molecular chaperone that prevents the formation of protein aggregates. provided by RefSeq, Dec 2016
Protein Families Druggable Genome
Protein Pathways Antigen processing and presentation
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ERp57" proteins (4)
SKU Description Size Price
LC401637 Lyophilized PDIA3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401637 Transient overexpression lysate of protein disulfide isomerase family A, member 3 (PDIA3) (as WB positive control) 100 ug
$436.00
TP305940 Recombinant protein of human protein disulfide isomerase family A, member 3 (PDIA3), 20 µg 20 ug
$737.00
TP721117 Purified recombinant protein of Human protein disulfide isomerase family A, member 3 (PDIA3 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products