OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IFI30 (NM_006332) Human Mass Spec Standard

Be the first to review this product
SKU
PH305877
IFI30 MS Standard C13 and N15-labeled recombinant protein (NP_006323)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA307992 Rabbit polyclonal antibody to GILT (interferon, gamma-inducible protein 30)
100 ul
$665.00
LY416719 Transient overexpression lysate of interferon, gamma-inducible protein 30 (IFI30) (as WB positive control) 100 ug
$436.00

Other products for "IFI30 or NM_006332"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205877
Predicted MW 28 kDa
Protein Sequence
Protein Sequence
>RC205877 protein sequence
Red=Cloning site Green=Tags(s)

MTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEA
LCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDME
LAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTV
NGKPLEDQTQLLTLVCQLYQGKKPDVCPSSTSSLRSVCFK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006323
RefSeq Size 1034
RefSeq ORF 750
Synonyms GILT; IFI-30; IP-30; IP30
Locus ID 10437
UniProt ID P13284
Cytogenetics 19p13.11
Summary The protein encoded by this gene is a lysosomal thiol reductase that at low pH can reduce protein disulfide bonds. The enzyme is expressed constitutively in antigen-presenting cells and induced by gamma-interferon in other cell types. This enzyme has an important role in MHC class II-restricted antigen processing. provided by RefSeq, Jul 2008
Protein Pathways Antigen processing and presentation
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "IFI30" proteins (3)
SKU Description Size Price
LC416719 Lyophilized IFI30 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416719 Transient overexpression lysate of interferon, gamma-inducible protein 30 (IFI30) (as WB positive control) 100 ug
$436.00
TP305877 Purified recombinant protein of Homo sapiens interferon, gamma-inducible protein 30 (IFI30), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products