OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TPX2 (NM_012112) Human Mass Spec Standard

Be the first to review this product
SKU
PH305821
TPX2 MS Standard C13 and N15-labeled recombinant protein (NP_036244)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA382768 TPX2 Rabbit polyclonal Antibody
100 ul
$410.00
LY415965 Transient overexpression lysate of TPX2, microtubule-associated, homolog (Xenopus laevis) (TPX2) (as WB positive control) 100 ug
$436.00

Other products for "TPX2 or NM_012112"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205821
Predicted MW 85.7 kDa
Protein Sequence
Protein Sequence
>RC205821 protein sequence
Red=Cloning site Green=Tags(s)

MSQVKSSYSYDAPSDFINFSSLDDEGDTQNIDSWFEEKANLENKLLGKNGTGGLFQGKTPLRKANLQQAI
VTPLKPVDNTYYKEAEKENLVEQSIPSNACSSLEVEAAISRKTPAQPQRRSLRLSAQKDLEQKEKHHVKM
KAKRCATPVIIDEILPSKKMKVSNNKKKPEEEGSAHQDTAEKNASSPEKAKGRHTVPCMPPAKQKFLKST
EEQELEKSMKMQQEVVEMRKKNEEFKKLALAGIGQPVKKSVSQVTKSVDFHFRTDERIKQHPKNQEEYKE
VNFTSELRKHPSSPARVTKGCTIVKPFNLSQGKKRTFDETVSTYVPLAQQVEDFHKRTPNRYHLRSKKDD
INLLPSKSSVTKICRDPQTPVLQTKHRARAVTCKSTAELEAEELEKLQQYKFKARELDPRILEGGPILPK
KPPVKPPTEPIGFDLEIEKRIQERESKKKTEDEHFEFHSRPCPTKILEDVVGVPEKKVLPITVPKSPAFA
LKNRIRMPTKEDEEEDEPVVIKAQPVPHYGVPFKPQIPEARTVEICPFSFDSRDKERQLQKEKKIKELQK
GEVPKFKALPLPHFDTINLPEKKVKNVTQIEPFCLETDRRGALKAQTWKHQLEEELRQQKEAACFKARPN
TVISQEPFVPKKEKKSVAEGLSGSLVQEPFQLATEKRAKERQELEKRMAEVEAQKAQQLEEARLQEEEQK
KEELARLRRELVHKANPIRKYQGLEIKSSDQPLTVPVSPKFSTRFHC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036244
RefSeq Size 3685
RefSeq ORF 2241
Synonyms C20orf1; C20orf2; DIL-2; DIL2; FLS353; GD:C20orf1; HCA519; HCTP4; p100; REPP86
Locus ID 22974
UniProt ID Q9ULW0
Cytogenetics 20q11.21
Summary Spindle assembly factor required for normal assembly of mitotic spindles. Required for normal assembly of microtubules during apoptosis. Required for chromatin and/or kinetochore dependent microtubule nucleation. Mediates AURKA localization to spindle microtubules (PubMed:18663142, PubMed:19208764). Activates AURKA by promoting its autophosphorylation at 'Thr-288' and protects this residue against dephosphorylation (PubMed:18663142, PubMed:19208764). TPX2 is inactivated upon binding to importin-alpha (PubMed:26165940). At the onset of mitosis, GOLGA2 interacts with importin-alpha, liberating TPX2 from importin-alpha, allowing TPX2 to activates AURKA kinase and stimulates local microtubule nucleation (PubMed:26165940).UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome, Stem cell - Pluripotency
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TPX2" proteins (3)
SKU Description Size Price
LC415965 Lyophilized TPX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415965 Transient overexpression lysate of TPX2, microtubule-associated, homolog (Xenopus laevis) (TPX2) (as WB positive control) 100 ug
$436.00
TP305821 Recombinant protein of human TPX2, microtubule-associated, homolog (Xenopus laevis) (TPX2), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products